PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.16435s0008.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family NF-YC
Protein Properties Length: 292aa    MW: 33104 Da    PI: 5.4577
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.16435s0008.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC56.65.6e-186861898
                 NF-YC 18 nhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98
                          ++++P arikki++adedv +i+  +Pvl+ska elf+ +l   ++  + +   +t+    ++++v+r ++fdfl ++v +
  Cagra.16435s0008.1.p  6 DTRFPAARIKKIMQADEDVGKIALAVPVLVSKALELFLQDLCDHTYEITLQRGAKTVSSLHLKNCVERYNVFDFLREVVSK 86
                          5789************************************************************************99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.6E-25372IPR009072Histone-fold
SuperFamilySSF471131.31E-19499IPR009072Histone-fold
PfamPF008084.1E-19871IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MRKKLDTRFP AARIKKIMQA DEDVGKIALA VPVLVSKALE LFLQDLCDHT YEITLQRGAK  60
TVSSLHLKNC VERYNVFDFL REVVSKVPDY GHGHGHSQGH ADVPMDDRNI SKRRKPQDDE  120
INDSDEDLKK TKVHEMGHAG PSGRGRGRGR GRGRGRSAKT AERELFHREM EIEPTILVAP  180
QLTQEEIKMH APPQQHGSEK KDVDERFNHT KQELESPDDT NSGLGRGFDL NSQSLDIEIK  240
PPVITASREE MKPEEYPCWS IPDMANIDPM QVANMSKRLD EDEEDYDEEE S*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_A1e-22272575Transcription Regulator NC2 alpha chain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1145154RGRGRGRGRG
2145155RGRGRGRGRGR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006287977.10.0hypothetical protein CARUB_v10001212mg, partial
TrEMBLR0H7M70.0R0H7M7_9BRAS; Uncharacterized protein (Fragment)
STRINGfgenesh1_pm.C_scaffold_60005421e-150(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM35062458
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12480.11e-100nuclear factor Y, subunit C11